PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna01013.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 363aa    MW: 40641.9 Da    PI: 9.9359
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna01013.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-182267147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg W + Ede+l ++v+q+G  +W++Ia++++ gR++k+c++rw++ 
  mrna01013.1-v1.0-hybrid 22 RGHWRPAEDERLRQLVEQYGAQNWNSIAEKLQ-GRSGKSCRLRWFNQ 67
                             899*****************************.***********996 PP

2Myb_DNA-binding57.63e-1874117146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              r ++++eE+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  mrna01013.1-v1.0-hybrid  74 RRPFSEEEEERLLAAHRIHGNK-WAMIARLFP-GRTDNAVKNHWHV 117
                              679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.7561768IPR017930Myb domain
SuperFamilySSF466891.98E-2920115IPR009057Homeodomain-like
SMARTSM007172.1E-142170IPR001005SANT/Myb domain
PfamPF002494.2E-172267IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-262375IPR009057Homeodomain-like
CDDcd001676.21E-142566No hitNo description
PROSITE profilePS5129427.2269123IPR017930Myb domain
SMARTSM007172.1E-1573121IPR001005SANT/Myb domain
PfamPF002491.5E-1474116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2176121IPR009057Homeodomain-like
CDDcd001671.19E-785116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MDDYGASPAG SADESKSTSC PRGHWRPAED ERLRQLVEQY GAQNWNSIAE KLQGRSGKSC  60
RLRWFNQLDP RINRRPFSEE EEERLLAAHR IHGNKWAMIA RLFPGRTDNA VKNHWHVIMA  120
RRQREQSKLI CGSKRSYQDF LISNDSLSNT SSSISNAFDL RILKSSTGFD HNQSSSTTST  180
VFEFRNPGKG RAMSFMESSR PKSSSCHNWN FASMTSSLSN PNSTSSSGFL RGSEISNYRV  240
SECFKGGNSD HRFVPRINGQ YSSPAFVYGR YRGSGSSSST FGLPNPRRVN VPINHFGCLS  300
SSTSPLGDIH EKHGSKMILK KEYQRAASAT TFEDHPHHHH DSSIEHNKEV PFIDFLGVGI  360
SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31221227107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004292552.10.0PREDICTED: myb-like protein AA
TrEMBLM5VN751e-122M5VN75_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s20870.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.14e-62myb domain protein 52